PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC11G13830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 397aa    MW: 42874 Da    PI: 8.9298
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC11G13830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC726.9e-23147190245
              WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       ep+rCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  OPUNC11G13830.1 147 VEPRRCRRTDGKKWRCSRDAVGDQKYCERHINRGRHRSRKHVEG 190
                      59***************************************996 PP

2QLQ58.22.5e-2094130137
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                      ++FT++Q+++L++Q+l+yK++aan+ vP+ Ll++i++
  OPUNC11G13830.1  94 GPFTPTQWMELEHQALIYKHIAANVSVPSSLLLPIRR 130
                      59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-1294130IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-1495129IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.88895130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.136146190IPR014977WRC domain
PfamPF088793.4E-19148189IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MLSSCGGHGN PRSLPQEHHG RCGEQQEQDG FLVREARASP PPSSSSFLGS TSSSVGEGGG  60
GGVQMLSFSS PNGTAGLGLS SGGSMQGVLA RVRGPFTPTQ WMELEHQALI YKHIAANVSV  120
PSSLLLPIRR SLHPWGWGSF PPGCADVEPR RCRRTDGKKW RCSRDAVGDQ KYCERHINRG  180
RHRSRKHVEG RKATVTIAEP PMVIAAGVSS CGHTVARQKQ VKSSAATVSD PFSRQSNRKF  240
LEKQAVVDQL SPMDSFDFSS TQSSPNYDNV ALSPLKLHHD HDESYIGHGT GSSSEKGNMM  300
HESRLTVSKE TLDDGPLGEV FKRKNSQSAS TDILTDKWTE SPNLHCPSGI LQMATKFNSM  360
SSGNTVNSGG TAVENLITDN GYLTARMMNP HIVPTLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1030550.0AK103055.1 Oryza sativa Japonica Group cDNA clone:J033117J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615703.10.0PREDICTED: growth-regulating factor 8
SwissprotQ6AWY10.0GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0E0MGA40.0A0A0E0MGA4_ORYPU; Uncharacterized protein
STRINGORGLA11G0141300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.16e-37growth-regulating factor 2